PDB entry 2o03

View 2o03 on RCSB PDB site
Description: Crystal structure of FurB from M. tuberculosis- a Zinc uptake regulator
Class: gene regulation
Keywords: Zinc uptake, DNA-binding, helix-turn-helix, Zinc binding, GENE REGULATION
Deposited on 2006-11-27, released 2007-02-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable Zinc uptake regulation protein FurB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: furB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05839 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.01: d2o03a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o03A (A:)
    masaagvrstrqraaistlletlddfrsaqelhdelrrrgeniglttvyrtlqsmassgl
    vdtlhtdtgesvyrrcsehhhhhlvcrscgstievgdheveawaaevatkhgfsdvshti
    eifgtcsdcrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o03A (A:)
    asaagvrstrqraaistlletlddfrsaqelhdelrrrgeniglttvyrtlqsmassglv
    dtlhtdtgesvyrrcsehhhhhlvcrscgstievgdheveawaaevatkhgfsdvshtie
    ifgtcsdcr