PDB entry 2nzj

View 2nzj on RCSB PDB site
Description: The crystal structure of REM1 in complex with GDP
Class: signaling protein
Keywords: REM1, GDP/GTP binding, GTP hydrolysis, Rad and Gem like GTP binding protein 1, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-11-23, released 2006-12-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein REM 1
    Species: Homo sapiens [TaxId:9606]
    Gene: REM1, GES, REM
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75628 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.03: d2nzja_
  • Chain 'B':
    Compound: GTP-binding protein REM 1
    Species: Homo sapiens [TaxId:9606]
    Gene: REM1, GES, REM
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75628 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.03: d2nzjb_
  • Chain 'C':
    Compound: GTP-binding protein REM 1
    Species: Homo sapiens [TaxId:9606]
    Gene: REM1, GES, REM
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75628 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.03: d2nzjc_
  • Chain 'D':
    Compound: GTP-binding protein REM 1
    Species: Homo sapiens [TaxId:9606]
    Gene: REM1, GES, REM
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75628 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.03: d2nzjd_
  • Heterogens: MG, CL, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nzjA (A:)
    smalyrvvllgdpgvgktslaslfagkqerdlheqlgedvyertltvdgedttlvvvdtw
    eaekldkswsqesclqggsayvivysiadrgsfesaselriqlrrthqadhvpiilvgnk
    adlarcrevsveegracavvfdckfietsatlqhnvaelfegvvrqlrlrrrdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzjA (A:)
    malyrvvllgdpgvgktslaslfagkheqlgedvyertltvdgedttlvvvdtwswsqes
    clqggsayvivysiadrgsfesaselriqlrrthvpiilvgnkadlarcrevsveegrac
    avvfdckfietsatlqhnvaelfegvvrqlrlrrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nzjB (B:)
    smalyrvvllgdpgvgktslaslfagkqerdlheqlgedvyertltvdgedttlvvvdtw
    eaekldkswsqesclqggsayvivysiadrgsfesaselriqlrrthqadhvpiilvgnk
    adlarcrevsveegracavvfdckfietsatlqhnvaelfegvvrqlrlrrrdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzjB (B:)
    malyrvvllgdpgvgktslaslfagkqerdlheqlgedvyertltvdgedttlvvvdtwe
    swsqesclqggsayvivysiadrgsfesaselriqlrrtvpiilvgnkadlarcrevsve
    egracavvfdckfietsatlqhnvaelfegvvrqlrlrrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nzjC (C:)
    smalyrvvllgdpgvgktslaslfagkqerdlheqlgedvyertltvdgedttlvvvdtw
    eaekldkswsqesclqggsayvivysiadrgsfesaselriqlrrthqadhvpiilvgnk
    adlarcrevsveegracavvfdckfietsatlqhnvaelfegvvrqlrlrrrdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzjC (C:)
    malyrvvllgdpgvgktslaslfagkheqlgedvyertltvdgedttlvvvdtweswsqe
    sclqggsayvivysiadrgsfesaselriqlrrthqadhvpiilvgnkadlarcrevsve
    egracavvfdckfietsatlqhnvaelfegvvrqlrlrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nzjD (D:)
    smalyrvvllgdpgvgktslaslfagkqerdlheqlgedvyertltvdgedttlvvvdtw
    eaekldkswsqesclqggsayvivysiadrgsfesaselriqlrrthqadhvpiilvgnk
    adlarcrevsveegracavvfdckfietsatlqhnvaelfegvvrqlrlrrrdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzjD (D:)
    malyrvvllgdpgvgktslaslfagqlgedvyertltvdgedttlvvvdtweswsqescl
    qggsayvivysiadrgsfesaselriqlrrthqadhvpiilvgnkadlarcrevsveegr
    acavvfdckfietsatlqhnvaelfegvvrqlrlr