PDB entry 2nzg

View 2nzg on RCSB PDB site
Description: Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9A crystal structure reveals the details
Class: toxin
Keywords: Protein-carbohydrate complex, cholera toxin, heat-labile enterotoxin, blood group antigen
Deposited on 2006-11-23, released 2007-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-09-23, with a file datestamp of 2008-09-19.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgd_
  • Chain 'E':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzge_
  • Chain 'F':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgf_
  • Chain 'G':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgg_
  • Chain 'H':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgh_
  • Chain 'I':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgi_
  • Chain 'J':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
  • Chain 'K':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgk_
  • Chain 'L':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgl_
  • Chain 'M':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae [TaxId:666]
    Domains in SCOPe 2.06: d2nzgm_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nzgD (D:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgD (D:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgqkkaie
    rmkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nzgE (E:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgE (E:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpsqkkaie
    rmkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2nzgF (F:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgF (F:)
    apqnitelcseyhntqiytindkilsyteslrgkemaiitfkngatfqvevdsqkkaier
    mkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2nzgG (G:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgG (G:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpqkkaier
    mkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2nzgH (H:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgH (H:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpghidsqk
    kaiermkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2nzgI (I:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgI (I:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpqkkaier
    mkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2nzgK (K:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgK (K:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvekkaiermkd
    tlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2nzgL (L:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgL (L:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpdsqkkai
    ermkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2nzgM (M:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nzgM (M:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma