PDB entry 2nxx

View 2nxx on RCSB PDB site
Description: Crystal Structure of the Ligand-Binding Domains of the T.castaneum (Coleoptera) Heterodimer EcrUSP Bound to Ponasterone A
Class: hormone/growth factor
Keywords: Hormone Receptor, apo and holo Ligand Binding Pocket, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-11-20, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.249
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ultraspiracle (USP, NR2B4)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ultraspiracle (USP)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxa_
  • Chain 'B':
    Compound: Ultraspiracle (USP, NR2B4)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ultraspiracle (USP)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxb_
  • Chain 'C':
    Compound: Ultraspiracle (USP, NR2B4)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ultraspiracle (USP)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxc_
  • Chain 'D':
    Compound: Ultraspiracle (USP, NR2B4)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ultraspiracle (USP)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxd_
  • Chain 'E':
    Compound: Ecdysone Receptor (EcR, NRH1)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ecdysone Receptor (EcR)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxe_
  • Chain 'F':
    Compound: Ecdysone Receptor (EcR, NRH1)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ecdysone Receptor (EcR)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxf_
  • Chain 'G':
    Compound: Ecdysone Receptor (EcR, NRH1)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ecdysone Receptor (EcR)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxg_
  • Chain 'H':
    Compound: Ecdysone Receptor (EcR, NRH1)
    Species: Tribolium castaneum [TaxId:7070]
    Gene: Ecdysone Receptor (EcR)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxxh_
  • Heterogens: P1A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nxxA (A:)
    mtsnlqadmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklv
    phftslpltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniy
    drvlselvnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrt
    thpnepgrfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegttds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxA (A:)
    dmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklvphftslp
    ltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniydrvlsel
    vnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrtthpnepg
    rfaklllrlpalrsiglkclehlfffkligdvpidtflmemleg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nxxB (B:)
    mtsnlqadmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklv
    phftslpltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniy
    drvlselvnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrt
    thpnepgrfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegttds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxB (B:)
    qadmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklvphfts
    lpltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniydrvls
    elvnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrtthpne
    pgrfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nxxC (C:)
    mtsnlqadmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklv
    phftslpltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniy
    drvlselvnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrt
    thpnepgrfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegttds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxC (C:)
    dmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklvphftslp
    ltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniydrvlsel
    vnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrtthpnepg
    rfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nxxD (D:)
    mtsnlqadmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklv
    phftslpltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniy
    drvlselvnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrt
    thpnepgrfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegttds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxD (D:)
    dmpleriieaekrvecndplvalvvnennttvnnicqathkqlfqlvqwaklvphftslp
    ltdqvqllragwnelliaafshrsmqaqdaivlatgltvnkstahavgvgniydrvlsel
    vnkmkemkmdktelgclraiilynpdvrgiksvqevemlrekiygvleeytrtthpnepg
    rfaklllrlpalrsiglkclehlfffkligdvpidtflmemlegttd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nxxE (E:)
    gshmngskgispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhitei
    tiltvqlivefakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqp
    ysrdsynlagmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiq
    eiylealrayvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflae
    iwdvdlkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxE (E:)
    ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa
    krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg
    etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd
    nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvdl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2nxxF (F:)
    gshmngskgispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhitei
    tiltvqlivefakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqp
    ysrdsynlagmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiq
    eiylealrayvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflae
    iwdvdlkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxF (F:)
    ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa
    krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg
    etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd
    nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2nxxG (G:)
    gshmngskgispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhitei
    tiltvqlivefakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqp
    ysrdsynlagmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiq
    eiylealrayvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflae
    iwdvdlkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxG (G:)
    ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa
    krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg
    etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd
    nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2nxxH (H:)
    gshmngskgispeqeelihrlvyfqneyehpseedvkriinqpmdgedqcdvrfrhitei
    tiltvqlivefakrlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqp
    ysrdsynlagmgetiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiq
    eiylealrayvdnrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflae
    iwdvdlkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxxH (H:)
    ispeqeelihrlvyfqneyehpseedvkriindgedqcdvrfrhiteitiltvqlivefa
    krlpgfdkllredqiallkacssevmmfrmarrydvqtdsilfvnnqpysrdsynlagmg
    etiedllhfcrtmysmrvdnaeyalltaivifserpaliegwkvekiqeiylealrayvd
    nrrkpkpgtifakllsvltelrtlgnqnsemcfslklknkklppflaeiwdvdl