PDB entry 2nxt

View 2nxt on RCSB PDB site
Description: Structural and kinetic effects of hydrophobic mutations in the active site of human carbonic anhydrase II
Class: lyase
Keywords: proton transfer, histidine 64, carbonic anhydrase, LYASE
Deposited on 2006-11-19, released 2007-04-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.161
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered (6)
    Domains in SCOPe 2.03: d2nxta_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nxtA (A:)
    mshhwgfgkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nnghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxtA (A:)
    hhwgfgkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk