PDB entry 2nxq

View 2nxq on RCSB PDB site
Description: Crystal structure of calcium binding protein 1 from Entamoeba histolytica: a novel arrangement of EF hand motifs
Class: metal binding protein
Keywords: EF hand motifs, calcium binding, METAL BINDING PROTEIN
Deposited on 2006-11-18, released 2007-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.258
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium-binding protein
    Species: Entamoeba histolytica [TaxId:294381]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxqa_
  • Chain 'B':
    Compound: calcium-binding protein
    Species: Entamoeba histolytica [TaxId:294381]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nxqb_
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nxqA (A:)
    maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
    fygsiqgqdlsddkiglkvlyklmdvdgdgkltkeevtsffkkhgiekvaeqvmkadang
    dgyitleeflefsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxqA (A:)
    aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf
    ygsiqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nxqB (B:)
    maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
    fygsiqgqdlsddkiglkvlyklmdvdgdgkltkeevtsffkkhgiekvaeqvmkadang
    dgyitleeflefsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nxqB (B:)
    aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf
    ygsi