PDB entry 2nwo

View 2nwo on RCSB PDB site
Description: Structural and kinetic effect of hydrophobic mutations in the active site of human carbonic anhydrase II
Class: lyase
Keywords: proton transfer, Histidine 64, carbonic anhydrase, LYASE
Deposited on 2006-11-16, released 2007-04-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-258)
      • engineered (61)
    Domains in SCOPe 2.03: d2nwoa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nwoA (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nlghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nwoA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnl
    ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk