PDB entry 2nwd

View 2nwd on RCSB PDB site
Description: Structure of chemically synthesized human lysozyme at 1 Angstrom resolution
Class: Hydrolase
Keywords: native chemical ligation, chemical protein synthesis, convergent synthesis, Hydrolase
Deposited on 2006-11-14, released 2006-12-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.134
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Lysozyme C
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
  Domains in SCOPe 2.03: d2nwdx1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nwdX (X:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv