PDB entry 2nvw

View 2nvw on RCSB PDB site
Description: Crystal sctucture of transcriptional regulator Gal80p from kluyveromymes lactis
Class: transcription
Keywords: transcription, galactose metabolism, repressor
Deposited on 2006-11-13, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06433 (23-478)
      • expression tag (7-9)
      • cloning artifact (10-22)
    Domains in SCOPe 2.07: d2nvwa1, d2nvwa2, d2nvwa3
  • Chain 'B':
    Compound: Galactose/lactose metabolism regulatory protein GAL80
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Gene: GAL80
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06433 (Start-478)
      • expression tag (7-9)
      • cloning artifact (10-22)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nvwA (A:)
    mgsshhhhhhssenlyfqghmlannnkrsklstvpssrpirvgfvgltsgkswvakthfl
    aiqqlssqfqivalynptlksslqtieqlqlkhatgfdslesfaqykdidmivvsvkvpe
    hyevvknilehssqnlnlrylyvewalaasvqqaeelysisqqranlqtiiclqgrkspy
    ivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfghtidv
    lqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkvpvsc
    sfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngngssngtdnn
    gaaaikdkekvtkspspstgtseeeqtmevfhlrnynsvvgnilriyesiadyhflgkpe
    skssrgpddlfastkfdkqgfrfegfptfkdaiilhrlidavfrsdkeektldvskimi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvwA (A:)
    hhhssenlyfqghmlannnkrsklstvpssrpirvgfvgltsgkswvakthflaiqqlss
    qfqivalynptlksslqtieqlqlkhatgfdslesfaqykdidmivvsvkvpehyevvkn
    ilehssqnlnlrylyvewalaasvqqaeelysisqqranlqtiiclqgrkspyivrakel
    isegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfghtidvlqyitgs
    yfqkinamisnniptqflldgkrtketisktcpdhllfqgilengkvpvscsfkggtpvk
    kltknlvidihgtkgdlkiegdsnlvlyfygikngeeqtmevfhlrnynsvvgnilriye
    siadyhflkfdkqgfrfegfptfkdaiilhrlidavfrsdkeektldvskimi
    

  • Chain 'B':
    No sequence available.