PDB entry 2nvv

View 2nvv on RCSB PDB site
Description: Crystal Structure of the Putative Acetyl-CoA hydrolase/transferase PG1013 from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR16.
Class: hydrolase
Keywords: alpha beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2006-11-13, released 2007-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.287
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA hydrolase/transferase family protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG1013
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVN7
      • modified residue (56)
      • modified residue (167)
      • modified residue (169)
      • modified residue (242)
      • modified residue (280)
      • modified residue (293)
      • modified residue (371-372)
      • modified residue (396)
      • modified residue (407)
      • modified residue (487)
      • modified residue (496)
    Domains in SCOPe 2.07: d2nvva1, d2nvva2
  • Chain 'B':
    Compound: Acetyl-CoA hydrolase/transferase family protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG1013
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVN7
      • modified residue (56)
      • modified residue (167)
      • modified residue (169)
      • modified residue (242)
      • modified residue (280)
      • modified residue (293)
      • modified residue (371-372)
      • modified residue (396)
      • modified residue (407)
      • modified residue (487)
      • modified residue (496)
    Domains in SCOPe 2.07: d2nvvb1, d2nvvb2
  • Chain 'C':
    Compound: Acetyl-CoA hydrolase/transferase family protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG1013
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVN7
      • modified residue (56)
      • modified residue (167)
      • modified residue (169)
      • modified residue (242)
      • modified residue (280)
      • modified residue (293)
      • modified residue (371-372)
      • modified residue (396)
      • modified residue (407)
      • modified residue (487)
      • modified residue (496)
    Domains in SCOPe 2.07: d2nvvc1, d2nvvc2
  • Chain 'D':
    Compound: Acetyl-CoA hydrolase/transferase family protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG1013
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVN7
      • modified residue (56)
      • modified residue (167)
      • modified residue (169)
      • modified residue (242)
      • modified residue (280)
      • modified residue (293)
      • modified residue (371-372)
      • modified residue (396)
      • modified residue (407)
      • modified residue (487)
      • modified residue (496)
    Domains in SCOPe 2.07: d2nvvd1, d2nvvd2
  • Chain 'E':
    Compound: Acetyl-CoA hydrolase/transferase family protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG1013
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVN7
      • modified residue (56)
      • modified residue (167)
      • modified residue (169)
      • modified residue (242)
      • modified residue (280)
      • modified residue (293)
      • modified residue (371-372)
      • modified residue (396)
      • modified residue (407)
      • modified residue (487)
      • modified residue (496)
    Domains in SCOPe 2.07: d2nvve1, d2nvve2
  • Chain 'F':
    Compound: Acetyl-CoA hydrolase/transferase family protein
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG1013
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVN7
      • modified residue (56)
      • modified residue (167)
      • modified residue (169)
      • modified residue (242)
      • modified residue (280)
      • modified residue (293)
      • modified residue (371-372)
      • modified residue (396)
      • modified residue (407)
      • modified residue (487)
      • modified residue (496)
    Domains in SCOPe 2.07: d2nvvf1, d2nvvf2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nvvA (A:)
    malrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftg
    astgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkv
    dvaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldpp
    arrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflv
    semkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrik
    fasgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifg
    ninsthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvk
    viisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhq
    elaksgdmrnvrwedymklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvvA (A:)
    alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga
    stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd
    vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa
    rrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflvs
    emkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrikf
    asgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifgn
    insthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvkv
    iisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhqe
    laksgdmrnvrwedym
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nvvB (B:)
    malrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftg
    astgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkv
    dvaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldpp
    arrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflv
    semkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrik
    fasgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifg
    ninsthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvk
    viisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhq
    elaksgdmrnvrwedymklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvvB (B:)
    alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga
    stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd
    vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa
    rrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflvs
    emkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrikf
    asgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifgn
    insthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvkv
    iisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhqe
    laksgdmrnvrwedym
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nvvC (C:)
    malrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftg
    astgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkv
    dvaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldpp
    arrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflv
    semkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrik
    fasgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifg
    ninsthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvk
    viisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhq
    elaksgdmrnvrwedymklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvvC (C:)
    alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga
    stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd
    vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa
    rrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflvs
    emkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrikf
    asgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifgn
    insthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvkv
    iisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhqe
    laksgdmrnvrwedym
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nvvD (D:)
    malrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftg
    astgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkv
    dvaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldpp
    arrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflv
    semkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrik
    fasgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifg
    ninsthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvk
    viisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhq
    elaksgdmrnvrwedymklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvvD (D:)
    alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga
    stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd
    vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa
    rrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflvs
    emkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrikf
    asgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifgn
    insthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvkv
    iisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhqe
    laksgdmrnvrwedym
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nvvE (E:)
    malrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftg
    astgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkv
    dvaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldpp
    arrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflv
    semkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrik
    fasgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifg
    ninsthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvk
    viisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhq
    elaksgdmrnvrwedymklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvvE (E:)
    alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga
    stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd
    vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa
    rrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflvs
    emkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrikf
    asgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifgn
    insthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvkv
    iisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhqe
    laksgdmrnvrwedym
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2nvvF (F:)
    malrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftg
    astgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkv
    dvaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldpp
    arrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflv
    semkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrik
    fasgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifg
    ninsthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvk
    viisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhq
    elaksgdmrnvrwedymklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nvvF (F:)
    alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga
    stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd
    vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa
    rrelpvytpsdrigkpyvqvdpakivgvvrtsepndesdfapldpvtqaigdnvaaflvs
    emkagripkdflplqsgvgnvanavlgalgdnpdipafnmyteviqdavialmkkgrikf
    asgcslsvsrsviqdiyanldffkdkillrpqeysnnpeivrrlgvitintaleadifgn
    insthvsgtrmmngiggsgdftrnsyvsifttpsvmkdgkissfvpmvahhdhsehsvkv
    iisewgvadlrgknpreraheiidkcvhpdyrpllrqylelgvkgqtpqnldccfafhqe
    laksgdmrnvrwedym