PDB entry 2nty

View 2nty on RCSB PDB site
Description: Rop4-GDP-PRONE8
Class: signaling protein
Keywords: complex of PRONE-GEF with Rop substrate, SIGNALING PROTEIN
Deposited on 2006-11-08, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.201
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Emb|CAB41934.1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g24620
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Emb|CAB41934.1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g24620
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Rac-like GTP-binding protein ARAC5
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ATU52350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ntyc_
  • Chain 'D':
    Compound: Rac-like GTP-binding protein ARAC5
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ATU52350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ntyd_
  • Heterogens: GDP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ntyC (C:)
    msasrfikcvtvgdgavgktcmlisytsntfptdyvptvfdnfsanvvvdgntvnlglwd
    tagqedynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkl
    dlrddkqffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ntyC (C:)
    srfikcvtvgdgavgktcmlisytsntfptptvfdnfsanvvvdgntvnlglwdtagqed
    ynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlrddk
    qffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ntyD (D:)
    msasrfikcvtvgdgavgktcmlisytsntfptdyvptvfdnfsanvvvdgntvnlglwd
    tagqedynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkl
    dlrddkqffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ntyD (D:)
    rfikcvtvgdgavgktcmlisytsntfptptvfdnfsanvvvdgntvnlglwdtagqedy
    nrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlrddkq
    ffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq