PDB entry 2ntt

View 2ntt on RCSB PDB site
Description: Crystal Structure of SEK
Class: toxin
Keywords: superantigen; T cell receptor, TOXIN
Deposited on 2006-11-08, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.165
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal enterotoxin K
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: sek
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HHK0 (0-215)
      • conflict (72)
      • cloning artifact (216)
    Domains in SCOPe 2.06: d2ntta1, d2ntta2, d2ntta3
  • Chain 'B':
    Compound: Staphylococcal enterotoxin K
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: sek
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HHK0 (0-215)
      • conflict (72)
      • cloning artifact (216)
    Domains in SCOPe 2.06: d2nttb1, d2nttb2, d2nttb3
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nttA (A:)
    qgdigidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgk
    kldvfgisyngqsntkyiyggvtatneyldksrnipiniwingnhktistnkvstnkkfv
    taqeidvklrkylqeeyniyghngtkkgeeyghkskfysgfnigkvtfhlnnndtfsydl
    fytgddglpksflkiyednktvesekfhldvdisyka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nttB (B:)
    qgdigidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgk
    kldvfgisyngqsntkyiyggvtatneyldksrnipiniwingnhktistnkvstnkkfv
    taqeidvklrkylqeeyniyghngtkkgeeyghkskfysgfnigkvtfhlnnndtfsydl
    fytgddglpksflkiyednktvesekfhldvdisyka