PDB entry 2nts

View 2nts on RCSB PDB site
Description: Crystal Structure of SEK-hVb5.1
Class: toxin/immune system
Keywords: superantigen; T cell receptor, TOXIN-IMMUNE SYSTEM COMPLEX
Deposited on 2006-11-08, released 2007-06-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal enterotoxin K
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: sek
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HHK0 (0-215)
      • conflict (72)
      • cloning artifact (216)
    Domains in SCOPe 2.03: d2ntsa1, d2ntsa2
  • Chain 'P':
    Compound: TRBC1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TRBC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ntsp1, d2ntsp2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ntsA (A:)
    qgdigidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgk
    kldvfgisyngqsntkyiyggvtatneyldksrnipiniwingnhktistnkvstnkkfv
    taqeidvklrkylqeeyniyghngtkkgeeyghkskfysgfnigkvtfhlnnndtfsydl
    fytgddglpksflkiyednktvesekfhldvdisyka
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ntsP (P:)
    gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfnetqrnkgnfpg
    rfsgrqfsnsrsemnvstlelgdsalylcassladrvnteaffgqgtrltvvedlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr