PDB entry 2nto

View 2nto on RCSB PDB site
Description: Structure of the Glutathione Transferase from Ochrobactrum anthropi in complex with glutathione
Class: transferase
Keywords: N-terminal alpha+beta domain; C-terminal all helical domain, TRANSFERASE
Deposited on 2006-11-08, released 2007-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Ochrobactrum anthropi [TaxId:529]
    Gene: GST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ntoa1, d2ntoa2
  • Heterogens: SO4, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ntoA (A:)
mklyykvgacslaphiilseaglpyeleavdlkakktadggdyfavnprgavpalevkpg
tvitqnaailqyigdhsdvaafkpaygsierarlqealgfcsdlhaafsglfapnlseea
ragvianinrrlgqleamlsdknaywlgddftqpdayasviigwgvgqkldlsaypkalk
lrervlarpnvqkafkeegln