PDB entry 2ntg

View 2ntg on RCSB PDB site
Description: Structure of Spin-labeled T4 Lysozyme Mutant T115R7
Class: hydrolase
Keywords: Nitroxide, Spin label, T4 lysozyme, Electron paramagnetic resonance, EPR
Deposited on 2006-11-07, released 2007-06-12
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.156
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Bacteriophage T4
  Gene: E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • engineered (53)
    • engineered (96)
    • modified residue (114)
  Domains in SCOP 1.75: d2ntga1
• Heterogens: BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ntgA (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl