PDB entry 2ntf

View 2ntf on RCSB PDB site
Description: Crystal Structure of a Quorum-Quenching Antibody in Complex with an N-Acyl-L-Homoserine Lactone Analog
Class: immune system
Keywords: Immunoglobulin, antibody, Fab, hapten complex, quorum sensing, homoserine lactone, IMMUNE SYSTEM
Deposited on 2006-11-07, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.18 Å
R-factor: 0.213
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Murine Antibody Fab RS2-1G9 Lambda Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ntfa1, d2ntfa2
  • Chain 'B':
    Compound: Murine Antibody Fab RS2-1G9 IGG1 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Murine Antibody Fab RS2-1G9 IGG1 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Murine Antibody Fab RS2-1G9 Lambda Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ntfl1, d2ntfl2
  • Heterogens: OHM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ntfA (A:)
    qavvtqesalttspgetvtltcrsstgavttrnyanwvqekpdhfftgligdtnnrapgv
    parfsgslighkaaltitgaqtedesvyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltagawerhssyscqvtheghtvekslsr
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ntfL (L:)
    qavvtqesalttspgetvtltcrsstgavttrnyanwvqekpdhfftgligdtnnrapgv
    parfsgslighkaaltitgaqtedesvyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltagawerhssyscqvtheghtvekslsr