PDB entry 2nt4

View 2nt4 on RCSB PDB site
Description: Receiver domain from Myxococcus xanthus social motility protein FrzS (H92F mutant)
Class: signaling protein
Keywords: social motility, signaling, receiver domain, two-component, SIGNALING PROTEIN
Deposited on 2006-11-06, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.124
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: response regulator homolog
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Gene: FrzS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68522 (3-126)
      • cloning artifact (1-2)
      • engineered (94)
    Domains in SCOPe 2.07: d2nt4a1, d2nt4a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nt4A (A:)
    gshmskkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdls
    agqngylicgklkkdddlknvpiviignpdgfaqfrklkahadeyvakpvdadqlverag
    aligfpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nt4A (A:)
    shmskkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsa
    gqngylicgklkkdddlknvpiviignpdgfaqfrklkahadeyvakpvdadqlveraga
    ligfpe