SCOPe 2.06: Structural Classification of Proteins

PDB entry 2nss

View 2nss on RCSB PDB site
Description: Nitrobenzene Modified Horse Heart Myoglobin
Class: oxygen storage/transport
Keywords: nitroso, nitro, nitrite, nitric oxide, no, heme, myoglobin, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2006-11-06, released 2007-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Myoglobin
Species: Equus caballus [TaxId:9796]
Database cross-references and differences (RAF-indexed):
- Uniprot P68082 (0-End)
Domains in SCOPe 2.06: d2nssa_
Heterogens: SO4, HEM, NBE, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2nssA (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Sequence, based on observed residues (ATOM records): (download)

>2nssA (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq