PDB entry 2nrl

View 2nrl on RCSB PDB site
Description: Blackfin tuna myoglobin
Class: transport protein
Keywords: myoglobin, globin, TRANSPORT PROTEIN
Deposited on 2006-11-02, released 2007-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.91 Å
R-factor: 0.149
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Thunnus atlanticus [TaxId:48168]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NRL
    Domains in SCOPe 2.06: d2nrla_
  • Heterogens: HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nrlA (A:)
    adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
    atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
    qtalrnvmgiiiadleanykelgfsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrlA (A:)
    adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
    atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
    qtalrnvmgiiiadleanykelgfs