PDB entry 2npr

View 2npr on RCSB PDB site
Description: Structural Studies on Plasmodium vivax Merozoite Surface Protein-1
Class: membrane protein
Keywords: egf-like domain, membrane protein
Deposited on 2006-10-29, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Merozoite surface protein 1
    Species: Plasmodium vivax (strain Belem) [TaxId:31273]
    Gene: MSP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2npra1, d2npra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nprA (A:)
    tmssehtcidtnvpdnaacyryldgteewrclltfkeeggkcvpasnvtckdnnggcape
    aeckmtdsnkivckctkegseplfegvfcs