PDB entry 2npm

View 2npm on RCSB PDB site
Description: crystal structure of Cryptosporidium parvum 14-3-3 protein in complex with peptide
Class: protein binding
Keywords: cell regulator protein 14-3-3, Cryptosporidium parvum, Structural genomics, Structural Genomics Consortium, SGC, PROTEIN BINDING
Deposited on 2006-10-27, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 domain containing protein
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: cgd3_1290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2npma_
  • Chain 'B':
    Compound: 14-3-3 domain containing protein
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: cgd3_1290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2npmb_
  • Chain 'X':
    Compound: consensus peptide for 14-3-3 proteins
    Database cross-references and differences (RAF-indexed):
    • PDB 2NPM (0-5)
  • Chain 'Y':
    Compound: consensus peptide for 14-3-3 proteins
    Database cross-references and differences (RAF-indexed):
    • PDB 2NPM (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2npmA (A:)
    gilrtqhtirdselniknskmsdsvnaresnvymaklaeqaerydemakymkdvvearqe
    seeltveernllsvayknavgsrrsswriissveqkehsrnaedaskmcgkyrskveael
    tdicndiltmldkhliptatspdskvfyfkmkgdyhryisefstgdskqssaedalkayk
    datvvakdlepthpirlglalnfsvfhyeilnepraaidmakeafemaieqldklsedcy
    kdstlimqllrdnltlwtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2npmA (A:)
    msdsvnaresnvymaklaeqaerydemakymkdvvearqeeltveernllsvayknavgs
    rrsswriissveqkehsrnaedaskmcgkyrskveaeltdicndiltmldkhliptatsp
    dskvfyfkmkgdyhryisefstgdskqssaedalkaykdatvvakdlepthpirlglaln
    fsvfhyeilnepraaidmakeafemaieqldklsedcykdstlimqllrdnltlwta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2npmB (B:)
    gilrtqhtirdselniknskmsdsvnaresnvymaklaeqaerydemakymkdvvearqe
    seeltveernllsvayknavgsrrsswriissveqkehsrnaedaskmcgkyrskveael
    tdicndiltmldkhliptatspdskvfyfkmkgdyhryisefstgdskqssaedalkayk
    datvvakdlepthpirlglalnfsvfhyeilnepraaidmakeafemaieqldklsedcy
    kdstlimqllrdnltlwtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2npmB (B:)
    svnaresnvymaklaeqaerydemakymkdvvearqseeltveernllsvayknavgsrr
    sswriissveqkehsrnaedaskmcgkyrskveaeltdicndiltmldkhliptatspds
    kvfyfkmkgdyhryisefstgdskqssaedalkaykdatvvakdlepthpirlglalnfs
    vfhyeilnepraaidmakeafemaieqldklsedcykdstlimqllrdnltlwta
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.