PDB entry 2nph

View 2nph on RCSB PDB site
Description: Crystal structure of HIV1 protease in situ product complex
Class: hydrolase
Keywords: anti-parallel beta sheet, HYDROLASE
Deposited on 2006-10-27, released 2006-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72874
      • engineered (94)
    Domains in SCOPe 2.07: d2npha_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72874 (0-98)
      • engineered (94)
    Domains in SCOPe 2.07: d2nphb_
  • Chain 'S':
    Compound: tetrapeptide fragment
    Database cross-references and differences (RAF-indexed):
    • PDB 2NPH (0-3)
  • Chain 'T':
    Compound: pentapeptide fragment
    Database cross-references and differences (RAF-indexed):
    • PDB 2NPH (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nphA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nphB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnf
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.