PDB entry 2nnx

View 2nnx on RCSB PDB site
Description: Crystal Structure of the H46R, H48Q double mutant of human [Cu-Zn] Superoxide Dismutase
Class: oxidoreductase
Keywords: Oxidoreductase; human; Cu-Zn superoxide dismutase; superoxide acceptor; familial amyotrophic lateral sclerosis mutant, OXIDOREDUCTASE
Deposited on 2006-10-24, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.07: d2nnxa_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.07: d2nnxb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.07: d2nnxc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
      • engineered (47)
    Domains in SCOPe 2.07: d2nnxd_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nnxA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nnxB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nnxC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nnxD (D:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq