PDB entry 2nnp

View 2nnp on RCSB PDB site
Description: Crystal structure analysis of HIV-1 protease mutant I84V with a inhibitor saquinavir
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, i84v, dimer, hydrolase-hydrolase inhibitor complex
Deposited on 2006-10-24, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (83)
      • engineered (94)
    Domains in SCOPe 2.07: d2nnpa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (83)
      • engineered (94)
    Domains in SCOPe 2.07: d2nnpb_
  • Heterogens: ROC, ACY, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nnpA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nnpB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf