PDB entry 2nna

View 2nna on RCSB PDB site
Description: Structure of the MHC class II molecule HLA-DQ8 bound with a deamidated gluten peptide
Class: immune system
Keywords: Major Histocompatibility complex HLA-DQ8, deamidated gluten peptide, post translational modification, IMMUNE SYSTEM
Deposited on 2006-10-24, released 2007-09-04
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-04, with a file datestamp of 2007-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II antigen
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MHC class II antigen
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y7F6 (15-End)
      • expression tag (13-14)
    Domains in SCOP 1.75: d2nnab1, d2nnab2
  • Chain 'C':
    Compound: gluten peptide
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nnaB (B:)
    ggggsiegrgsgggsrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvg
    vyravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsr
    tealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtp
    qrgdvytchvehpslqnpiivewraqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nnaB (B:)
    gsrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaa
    eywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispllvcsvtdfypaqik
    vrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivew
    ra
    

  • Chain 'C':
    No sequence available.