PDB entry 2nn2

View 2nn2 on RCSB PDB site
Description: Crystal structure of the BTB domain from the LRF/ZBTB7 transcriptional regulator
Class: transcription
Keywords: Protein-protein interaction domain, transcription repressor, zinc-finger protein, BTB domain, candidate oncoprotein, POZ Domain
Deposited on 2006-10-23, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger and BTB domain-containing protein 7A
    Species: Homo sapiens [TaxId:9606]
    Gene: ZBTB7A, FBI1, LRF, ZBTB7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nn2a_
  • Chain 'B':
    Compound: Zinc finger and BTB domain-containing protein 7A
    Species: Homo sapiens [TaxId:9606]
    Gene: ZBTB7A, FBI1, LRF, ZBTB7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nn2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nn2A (A:)
    gsmaggvdgpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqy
    fkklftsgavvdqqnvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipa
    vshvcadlldrqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn2A (A:)
    gpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsq
    nvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlldr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nn2B (B:)
    gsmaggvdgpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqy
    fkklftsgavvdqqnvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipa
    vshvcadlldrqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn2B (B:)
    gpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsq
    nvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlldr