PDB entry 2nmp

View 2nmp on RCSB PDB site
Description: Crystal structure of human Cystathionine gamma lyase
Class: lyase
Keywords: amino-acid biosynthesis, lyase, pyridoxal phopshate, structural genomics, Structural Genomics Consortium, SGC
Deposited on 2006-10-23, released 2006-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.18
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nmpa_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nmpb_
  • Chain 'C':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nmpc_
  • Chain 'D':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nmpd_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nmpA (A:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nmpA (A:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgnptrnclekavaaldgaky
    clafasglaatvtithllkagdqiicmddvyggtnryfrqvasefglkisfvdcskikll
    eaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspyfqrplalga
    dismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcylcnrglktlh
    vrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmvtfyikgtlq
    haeiflknlklftlaeslggfeslaelpaimthasvlkndrdvlgisdtlirlsvglede
    edlledldqalkaahp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nmpB (B:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nmpB (B:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfeysrsgnptrn
    clekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefg
    lkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdnt
    fmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpsp
    idcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctg
    ctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaiisdtlirlsvgledee
    dlledldqalkaahpp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nmpC (C:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nmpC (C:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqgfeysrsgnptrncl
    ekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefglk
    isfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfm
    spyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspid
    cylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgct
    gmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasvlkndrdvlgisd
    tlirlsvgledeedlledldqalkaahpps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nmpD (D:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nmpD (D:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfeysrsgnptrn
    clekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefg
    lkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdnt
    fmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpsp
    idcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctg
    ctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthaskndrdvlgisd
    tlirlsvgledeedlledldqalkaahpps