PDB entry 2nmb

View 2nmb on RCSB PDB site
Description: dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.
Class: cell cycle/gene regulation
Keywords: complex, signal transduction, phosphotyrosine binding domain (ptb), asymetr ic cell division, cell cycle/gene regulation complex
Deposited on 1998-10-29, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (numb protein)
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: NUMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16554 (Start-153)
      • see remark 999 (154-158)
    Domains in SCOPe 2.07: d2nmba_
  • Chain 'B':
    Compound: protein (gppy peptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 2NMB (0-6)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nmbA (A:)
    gspgipdrvpesskphqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrq
    srrrpvrgllhvsgdglrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrr
    wmchgflackdsgerlshavgcafavclerkqrrtraaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nmbA (A:)
    skphqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhv
    sgdglrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackds
    gerlshavgcafavclerkqrrtraaa
    

  • Chain 'B':
    No sequence available.