PDB entry 2nm1

View 2nm1 on RCSB PDB site
Description: Structure of BoNT/B in complex with its protein receptor
Class: toxin,hydrolase
Keywords: neurotransmission, botulism, synaptotagmin, TOXIN,HYDROLASE
Deposited on 2006-10-20, released 2006-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.199
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10844 (0-433)
      • cloning artifact (434-435)
    Domains in SCOPe 2.06: d2nm1a1, d2nm1a2, d2nm1a3
  • Chain 'B':
    Compound: Synaptotagmin-2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NM1 (0-16)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nm1A (A:)
    seilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqni
    ifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlid
    ingktksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdirevian
    geiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseylkdfwgnplmynke
    yymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigekfiirrksnsqsin
    ddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdefyntiqikeydeqp
    tyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskwylkevkrkpynlklg
    cnwqfipkdegwtepp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nm1A (A:)
    seilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqni
    ifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlid
    ingktksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdirevian
    geiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseylkdfwgnplmynke
    yymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigekfiirrksddivrk
    edyiyldffnlnqewrvytykyfkkeeeklflapisdsdefyntiqikeydeqptyscql
    lfkkdeestdeigligihrfyesgivfeeykdyfciskwylkevkrkpynlklgcnwqfi
    pkdegwtepp
    

  • Chain 'B':
    No sequence available.