PDB entry 2nbw

View 2nbw on RCSB PDB site
Description: Solution structure of the Rpn1 T1 site with the Rad23 UBL domain
Class: protein binding
Keywords: protein binding
Deposited on 2016-03-14, released 2016-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26s proteasome regulatory subunit rpn1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: RPN1, HRD2, NAS1, RPD1, YHR027C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: UV excision repair protein RAD23
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: RAD23, YEL037C, SYGP-ORF29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nbwb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nbwB (B:)
    mvsltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsec
    glkdgdqvvfmvsqkkst