PDB entry 2na0

View 2na0 on RCSB PDB site
Description: NMR structure of Guanylyl Cyclase Activator Protein 1 (GCAP1) mutant V77E in a Ca2+-free/Mg2+-bound Activator State
Class: Lyase Activator
Keywords: Signal transduction, Activator state, Lyase Activator
Deposited on 2015-12-16, released 2015-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-06, with a file datestamp of 2015-12-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylyl cyclase-activating protein 1
    Species: Bos taurus [TaxId:9913]
    Gene: GUCA1A, GCAP1, GUCA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46065 (1-End)
      • see remark 999 (0)
      • engineered mutation (76)
    Domains in SCOPe 2.06: d2na0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2na0A (A:)
    xgnimdgksveelsstechqwykkfmtecpsgqltlyefrqffglknlspwasqyveqmf
    etfdfnkdgyidfmeyeaalslvlkgkveqklrwyfklydvdgngcidrdelltiirair
    ainpcsdstmtaeeftdtvfskidvngdgelsleefmegvqkdqmlldtltrsldltriv
    rrlqngeqdeegasgreteaaeadg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2na0A (A:)
    xgnimdgksveelsstechqwykkfmtecpsgqltlyefrqffglknlspwasqyveqmf
    etfdfnkdgyidfmeyeaalslvlkgkveqklrwyfklydvdgngcidrdelltiirair
    ainpcsdstmtaeeftdtvfskidvngdgelsleefmegvqkdqmlldtltrsldltriv
    rrlqn