PDB entry 2n9p

View 2n9p on RCSB PDB site
Description: Solution structure of RNF126 N-terminal zinc finger domain in complex with BAG6 Ubiquitin-like domain
Class: ligase
Keywords: E3 ligase, zinc finger, LIGASE
Deposited on 2015-12-01, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase RNF126
    Species: Homo sapiens [TaxId:9606]
    Gene: Rnf126
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BV68 (2-41)
      • expression tag (0-1)
  • Chain 'C':
    Compound: Large proline-rich protein BAG6
    Species: Homo sapiens [TaxId:9606]
    Gene: BAG6, BAT3, G3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46379 (15-99)
      • expression tag (0-14)
    Domains in SCOPe 2.07: d2n9pc1, d2n9pc2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n9pC (C:)
    mahhhhhhvddddkmlevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliy
    qgrvlqddkklqeynvggkvihlverappqthlpsgassg