PDB entry 2n9k

View 2n9k on RCSB PDB site
Description: 1H, 13C, and 15N Chemical Shift Assignments for in vitro GB1
Class: immune system
Keywords: in-cell NMR, Protein G B1, IMMUNE SYSTEM
Deposited on 2015-11-26, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-56)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2n9ka1, d2n9ka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n9kA (A:)
    mgtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte