PDB entry 2n9g

View 2n9g on RCSB PDB site
Description: Solution structure of the bromodomain of Trypanosoma brucei Bromodomain Factor 2(BDF2)
Class: gene regulation
Keywords: gene regulation
Deposited on 2015-11-23, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative uncharacterized protein
  Species: Trypanosoma brucei brucei TREU927 [TaxId:185431]
  Gene: Tb10.6k15.3240
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q38AM1 (0-110)
  Domains in SCOPe 2.07: d2n9ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n9gA (A:)
  msknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgi
  ekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsg