PDB entry 2n8z

View 2n8z on RCSB PDB site
Description: Apo form of Calmodulin-Like Domain of Human Non-Muscle alpha-actinin 1
Class: Calcium binding protein
Keywords: Calcium binding protein, STRUCTURAL PROTEIN
Deposited on 2015-10-28, released 2016-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-actinin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12814 (3-152)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d2n8za1, d2n8za2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n8zA (A:)
    gssisqeqmnefrasfnhfdrdhsgtlgpeefkaclislgydigndpqgeaefarimsiv
    dpnrlgvvtfqafidfmsretadtdtadqvmasfkilagdknyitmdelrrelppdqaey
    ciarmapytgpdsvpgaldymsfstalygesdl