PDB entry 2n7j

View 2n7j on RCSB PDB site
Description: Sidechain chi1 distribution in B3 domain of protein G from extensive sets of residual dipolar couplings
Class: signaling protein
Keywords: signaling protein
Deposited on 2015-09-12, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (2-55)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2n7ja1, d2n7ja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n7jA (A:)
    mqyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte