PDB entry 2n7a

View 2n7a on RCSB PDB site
Description: Solution structure of the human Siglec-8 lectin domain
Class: structural protein
Keywords: Sialic acid-binding immunoglobulin-like lectin 8, Siglec8, SAF-2, I-type lectin, carbohydrate-binding receptor, STRUCTURAL PROTEIN
Deposited on 2015-09-07, released 2016-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid-binding Ig-like lectin 8
    Species: Homo sapiens [TaxId:9606]
    Gene: SAF2, SIGLEC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NYZ4 (0-138)
      • engineered mutation (25)
      • expression tag (139-144)
    Domains in SCOPe 2.08: d2n7aa1, d2n7aa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n7aA (A:)
megdrqygdgyllqvqelvtvqeglsvhvpcsfsypqdgwtdsdpvhgywfragdrpyqd
apvatnnpdrevqaetqgrfqllgdiwsndcslsirdarkrdkgsyffrlergsmkwsyk
sqlnyktkqlsvfvtalthgslvpr