PDB entry 2n4i

View 2n4i on RCSB PDB site
Description: The solution structure of Skint-1, a critical determinant of dendritic epidermal gamma-delta T cell selection
Class: signaling protein
Keywords: Immune stress surveillance, thymic organ culture, SIGNALING PROTEIN
Deposited on 2015-06-18, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Selection and upkeep of intraepithelial T-cells protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Skint1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7TZE6 (1-118)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2n4ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n4iA (A:)
    mssepfivnglegpvlaslggnlelscqlsppqqaqhmeirwfrnlytepvhlyrdgkdm
    fgeiiskyvertellkdgigegkvtlrifnvtvdddgsyhcvfkdgdfyeehitevkit