PDB entry 2n3l

View 2n3l on RCSB PDB site
Description: Solution structure of RNA recognition motif-1 of Plasmodium falciparum serine/arginine-rich protein 1.
Class: RNA binding protein
Keywords: RNA recognition motif, serine/arginine-rich protein 1, RNA BINDING PROTEIN
Deposited on 2015-06-05, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/arginine-rich protein 1, PfSR1-RRM1
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PFE0865c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I3T5 (3-88)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d2n3la1, d2n3la2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n3lA (A:)
    gshmviresvsriyvgnlpshvssrdvenefrkygnilkcdvkktvsgaafafiefedar
    daadaikekdgcdfegnklrvevpfnare