PDB entry 2mzs

View 2mzs on RCSB PDB site
Description: NMR structure of the RRM2 domain of Hrb1
Class: RNA binding protein
Keywords: RRM, RNA binding domain, Hrb1, THO/TREX, RNA binding protein
Deposited on 2015-02-23, released 2015-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein HRB1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: HRB1, N2009, TOM34, YNL004W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38922 (2-98)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d2mzsa1, d2mzsa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mzsA (A:)
  gsevivknlpasvnwqalkdifkecgnvahadveldgdgvstgsgtvsfydikdlhraie
  kyngysiegnvldvkskesvhnhsdgddvdipmddspvn