PDB entry 2mzq

View 2mzq on RCSB PDB site
Description: NMR structure of the RRM3 domain of Gbp2
Class: RNA binding protein
Keywords: RRM, RNA binding domain, Gbp2, THO/TREX, RNA binding protein
Deposited on 2015-02-23, released 2015-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Single-strand telomeric DNA-binding protein GBP2
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: GBP2, RLF6, YCL011C, YCL11C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25555 (2-100)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2mzqa1, d2mzqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mzqA (A:)
  gshidetaakftegvnpggdrncfiycsnlpfstarsdlfdlfgpigkinnaelkpqeng
  qptgvavveyenlvdadfciqklnnynyggcslqisyarrd