PDB entry 2mzi

View 2mzi on RCSB PDB site
Description: NMR Solution Structure of the PRO Form of Human Matrilysin (proMMP-7) in Complex with Anionic Membrane
Class: hydrolase
Keywords: zymogen, hydrolase, membrane-bound form, metalloenzyme, anionic
Deposited on 2015-02-12, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrilysin
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP7, MPSL1, PUMP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09237 (Start-249)
      • engineered mutation (197)
    Domains in SCOPe 2.07: d2mzia1, d2mzia2
  • Heterogens: CA, ZN, PX4, C3S

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mziA (A:)
    lplpqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsr
    vieimqkprcgvpdvaeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwg
    keiplhfrkvvwgtadimigfargahgdsypfdgpgntlahafapgtglggdahfdeder
    wtdgsslginflyaathalghslgmghssdpnavmyptygngdpqnfklsqddikgiqkl
    ygkrsnsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mziA (A:)
    lpqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvi
    eimqkprcgvpdvaeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgke
    iplhfrkvvwgtadimigfargahgdsypfdgpgntlahafapgtglggdahfdederwt
    dgsslginflyaathalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklyg
    krsnsrkk