PDB entry 2mzh

View 2mzh on RCSB PDB site
Description: NMR Solution Structure of the PRO Form of Human Matrilysin (proMMP-7) in Complex with Zwitterionic Membrane
Class: hydrolase
Keywords: zymogen, hydrolase, zwitterionic membrane-bound form, metalloenzyme
Deposited on 2015-02-12, released 2015-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrilysin
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP7, MPSL1, PUMP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09237 (0-247)
      • engineered mutation (195)
    Domains in SCOPe 2.07: d2mzha1, d2mzha2
  • Heterogens: CA, ZN, PX4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mzhA (A:)
    lpqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvi
    eimqkprcgvpdvaeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgke
    iplhfrkvvwgtadimigfargahgdsypfdgpgntlahafapgtglggdahfdederwt
    dgsslginflyaathalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklyg
    krsnsrkk