PDB entry 2mys

View 2mys on RCSB PDB site
Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains
Deposited on 1996-06-27, released 1997-01-11
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mysA (A:)
    daemaafgeaapylrxsekerieaqnxpfdaxssvfvvhpkqsfvxgtiqsxeggxvtvx
    teggetltvkedqvfsmnppxydxiedmammthlhepavlynlxeryaawmiytysglfc
    vtvnpyxwlpvynpxvvlayrgkkrqeapphifsisdnayqfmltdrenqsilitgesga
    gktvntxrviqyfatiaasgekkkeeqsgkmqgtledqiisanplleafgnaxtvrndns
    srfgxfirihfgatgklasadietyllexsrvtfqlpaersyhifyqimsnxxpelidml
    littnpydyhyvsegeitvpsiddqeelmatdsaidilgfsadextaiyxltgavmhygn
    lkfxqxqreeqaepdgtevadxaaylmglnsaellkalcyprvgvgneavtxgetvsevh
    nsvgalaxavyexmflwmvirinqqldtkqprqyfigvldiagfeifdfnsfeqlcinft
    nexlqqffnhhmfvleqeeyxxegiewefidfgmdlaacieliexpmgifsileeecmfp
    katdtsfxnxlydehlgksnnfqkpkpakgkaeahfslvhyagtvdynisgwlexnxdpl
    netviglyqxssvxtlallfatyggeaeggggkkggkkkgssfqtvsalfrenlnxlman
    lrsthphfvrciipnetxtpgamehelvlhqlrcngvlegiricrkgfpsrvlyadfkqr
    yrvlnasaipegqfmdskkasekllgggdvdhtqyafghtxvffxagllglleemrddxl
    aeiitatqarcrgflmrveyramverresifciqynvrsfmnvxhwpwmxlffxixpllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mysA (A:)
    daemaafgeaapylrsekerieaqnpfdassvfvvhpkqsfvgtiqseggvtvteggetl
    tvkedqvfsmnppydiedmammthlhepavlynleryaawmiytysglfcvtvnpywlpv
    ynpvvlayrgkkrqeapphifsisdnayqfmltdrenqsilitgesgagktvntrviqyf
    atiaasgegtledqiisanplleafgnatvrndnssrfgfirihfgatgklasadietyl
    lesrvtfqlpaersyhifyqimsnpelidmllittnpydyhyvsegeitvpsiddqeelm
    atdsaidilgfsadetaiyltgavmhygnlkfqqreeqaepdgtevadaaylmglnsael
    lkalcyprvgvgneavtgetvsevhnsvgalaavyemflwmvirinqqldtkqprqyfig
    vldiagfeifdfnsfeqlcinftnelqqffnhhmfvleqeeyegiewefidfgmdlaaci
    eliepmgifsileeecmfpkatdtsfnlydehlgksnnfqkpkpaaeahfslvhyagtvd
    ynisgwlendplnetviglyqssvtlallfatyqtvsalfrenlnlmanlrsthphfvrc
    iipnettpgamehelvlhqlrcngvlegiricrkgfpsrvlyadfkqryrvlnasamdsk
    kasekllgggdvdhtqyafghtvffagllglleemrddlaeiitatqarcrgflmrveyr
    amverresifciqynvrsfmnvhwpwmlffipllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2mysB (B:)
    fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
    vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
    afppdvagnvdyknicyvithgeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mysB (B:)
    fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
    vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggftpeeiknmwaa
    fpvdyknicyvithgeda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2mysC (C:)
    aaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaait
    feeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteeeve
    elmkgqedsngcinyeafvkhimsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mysC (C:)
    aaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkiaaitfeeflpmlqaa
    annkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteeeveelmkgqedsng
    cinyeafvkhimsv