PDB entry 2myo

View 2myo on RCSB PDB site
Description: solution structure of myotrophin, nmr, minimized average structure
Deposited on 1998-08-17, released 1999-08-17
The last revision prior to the SCOP 1.57 freeze date was dated 1999-08-17, with a file datestamp of 1999-08-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d2myo__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2myo_ (-)
  mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad
  inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq