PDB entry 2myi

View 2myi on RCSB PDB site
Description: Solution Structure of Crc from P. syringae Lz4W
Class: RNA binding protein
Keywords: Crc, Catabolite Repression Control Protein, RNA BINDING PROTEIN
Deposited on 2015-01-25, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease III
    Species: Pseudomonas sp. Lz4W [TaxId:1206777]
    Gene: B195_00495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2myia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2myiA (A:)
    mriisvnvngiqtavergllswlqaqnadviclqdtrasafelddpayqldgyflyacea
    evpaqggvalysrlqpkavitglgfetadrygrylqadfdkvsiatlllpsgqngdedln
    qkfklmddfaryldkqrrkrreyiycgslyvaqqkldiknwrdsqqspgflaperawmde
    ivgnmgyvdalrevsregdqyswwpdneqaemlnlgwrfdyqlltpglrrfvrsarlprq
    prfsqhaplivdydwtlti