PDB entry 2mya

View 2mya on RCSB PDB site
Description: high resolution x-ray structures of myoglobin-and hemoglobin-alkyl isocyanide complexes
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-08-04, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: myoglobin (ethyl isocyanide)
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOPe 2.06: d2myaa_
• Heterogens: SO4, HEM, ENC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2myaA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg