PDB entry 2my7

View 2my7 on RCSB PDB site
Description: NMR Structure of unfolding intermediate state of RRM-3 domain of ETR-3
Class: RNA binding protein
Keywords: ETR 3 RRM-3, Intermediate state, Protein folding, RNA BINDING PROTEIN
Deposited on 2015-01-21, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CUGBP Elav-like family member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95319 (4-96)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d2my7a1, d2my7a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2my7A (A:)
    gshmqkegpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsy
    dnpvsaqaaiqamngfqigmkrlkvqlkrskndskpy