PDB entry 2mws

View 2mws on RCSB PDB site
Description: Structure of the complex of ubiquitin and the ubiquitin-like (UBL) domain of Ddi1
Class: protein transport
Keywords: UBL, Ddi1, Ubiquitin, proteasome, PROTEIN TRANSPORT
Deposited on 2014-11-23, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-75)
      • engineered mutation (11)
    Domains in SCOPe 2.06: d2mwsa_
  • Chain 'B':
    Compound: DNA damage-inducible protein 1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: DDI1, VSM1, YER143W
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mwsA (A:)
    mqifvktltgkxitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'B':
    No sequence available.