PDB entry 2mst

View 2mst on RCSB PDB site
Description: musashi1 rbd2, nmr
Class: RNA binding protein
Keywords: RNA-binding domain, RNA binding protein
Deposited on 1999-05-19, released 2000-05-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (musashi1)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2msta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mstA (A:)
    kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei
    hfheinnkmveckka